PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013598572.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 300aa    MW: 32851 Da    PI: 8.9059
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013598572.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.82.8e-19651147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde+l ++v ++G+++W+ I++ ++ gR++k+c++rw + 
   XP_013598572.1  6 KGPWSPEEDEQLRKLVVKYGPRNWTVISKSIP-GRSGKSCRLRWCNQ 51
                     79******************************.***********985 PP

2Myb_DNA-binding56.56.6e-1860102347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++eEde +++a++q+G++ W+tIar ++ gRt++ +k++w++ 
   XP_013598572.1  60 PFSAEEDETIARAHAQFGNK-WATIARLLN-GRTDNAVKNHWNST 102
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.899156IPR017930Myb domain
SuperFamilySSF466892.92E-31399IPR009057Homeodomain-like
SMARTSM007171.3E-17554IPR001005SANT/Myb domain
PfamPF002496.4E-19651IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-25758IPR009057Homeodomain-like
CDDcd001677.01E-17850No hitNo description
SMARTSM007171.3E-1457105IPR001005SANT/Myb domain
PROSITE profilePS5129419.7758107IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2259106IPR009057Homeodomain-like
CDDcd001678.26E-1260103No hitNo description
PfamPF002496.8E-1560102IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010200Biological Processresponse to chitin
GO:0042742Biological Processdefense response to bacterium
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000031Biological Processregulation of salicylic acid mediated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MADRIKGPWS PEEDEQLRKL VVKYGPRNWT VISKSIPGRS GKSCRLRWCN QLSPQVEHRP  60
FSAEEDETIA RAHAQFGNKW ATIARLLNGR TDNAVKNHWN STLKRKCGGF YAPAEDQRPV  120
KRSVSDGYPP VANGLYMSPG SPTGSDVSDS STLPVLPSVE VFKPVPRAGG VTLPLPIETS  180
SFCDDPATSL SLSLPGADVS EESNRSHEST SNNTLMRHNT NTMSFKQFSG GFRGAIEDMG  240
RSFAGNGVEF MAVVQEMIKA EVRSYMAEMQ RNHNGGGFVV GGFRDKGMIP MSQIGVGRIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-4051073105MYB PROTO-ONCOGENE PROTEIN
1mse_C4e-4051073105C-Myb DNA-Binding Domain
1msf_C4e-4051073105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00596DAPTransfer from AT5G67300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667370.0KC966737.1 Brassica napus MYB transcription factor 44 (MYB44.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013686217.10.0PREDICTED: transcription factor MYB44-like
RefseqXP_013598572.10.0PREDICTED: transcription factor MYB44
SwissprotQ9FDW11e-173MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D3D8660.0A0A0D3D866_BRAOL; Uncharacterized protein
STRINGBra012149.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.11e-175myb domain protein r1